PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG039448t1
Common NameTCM_039448
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HB-PHD
Protein Properties Length: 744aa    MW: 83729.9 Da    PI: 10.0152
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG039448t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.19.4e-11518562953
                       HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
          Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                       ++ +e L ++F++n  ps+  +e L+k+lgL+ ++V  WF+N R+
  Thecc1EG039448t1 518 PTAVEKLRQVFAENELPSRVIKENLSKELGLEPEKVNKWFKNARY 562
                       67899**************************************97 PP

2PHD34.83.7e-12253308151
                       SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
               PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                       +C+ C+   +  ++++vlCd +C+ +fH+kCl+++l++e++p g   w+C+ C++k
  Thecc1EG039448t1 253 FCAKCKLheAFPDNDIVLCDgTCNCAFHQKCLDPPLDTENIPPGeqGWFCKFCDCK 308
                       699999854445********56********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579033.77E-13245311IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.106.4E-11249308IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.14251308IPR019787Zinc finger, PHD-finger
SMARTSM002492.8E-7253306IPR001965Zinc finger, PHD-type
CDDcd155042.77E-31253305No hitNo description
PfamPF006282.2E-9253308IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590254305IPR019786Zinc finger, PHD-type, conserved site
SuperFamilySSF466895.13E-11502562IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-13503561IPR009057Homeodomain-like
PROSITE profilePS5007112.536507567IPR001356Homeobox domain
SMARTSM003892.8E-11509571IPR001356Homeobox domain
CDDcd000864.01E-9510569No hitNo description
PfamPF000463.0E-8518562IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MRTVATSFSF DTAEISMRGT GKKVVDHESA KSSSSKKEAG SKLIATLQFK KRSKISHGRV  60
RKPKYHVKKV GSALLKTKVN ASISKGTGND VSSSKKVGTK TNLHKANKKG SSKKLDSCKL  120
QGKNAASGSS EENSKKANED VRIKNLTKKK KKRQKDKVEL DEASRLQRRT RYLLIKMKLE  180
QNLIDAYSGE GWKGQSREKI KPEKELQRAK KQILKCKLGI REAIRQLDSL SSVGSIEGSV  240
IAPDGSVYHE HIFCAKCKLH EAFPDNDIVL CDGTCNCAFH QKCLDPPLDT ENIPPGEQGW  300
FCKFCDCKME IIEAMNAHIG THFSVDSHWQ DIFKDEAAFP DGVIASLNPE EEWPSDDSED  360
DDYDPERREN SCGISGAALD GDDTDDTDSS TSLSWSVDGE DFSGSGRREN HSVDSGADSY  420
ETSDGEIISG RRRRRAVDYK KLYDEMFGKD APSYEQVSED EDWGPGKRKR REKESDAAST  480
LMTLYESETK YPNVETTEMR GQLPSDPKSR RPIFRIPPTA VEKLRQVFAE NELPSRVIKE  540
NLSKELGLEP EKVNKWFKNA RYLALKSRKV ERADHLQSSS PGVSKESELE ASKRKDPNIP  600
QLEDTSKKTL LHTPKRLKKK VRKSPNSKSL HSSLRRSAQN GLSLVSPANS NKVRKELSDD  660
VILKKLLKGK KKREKKRVNI TVGGGLQQFE LEMERLCRVK VRLENMRQTL LRLETSKARK  720
LNKNRLQEES VIYIPIAEVK QKV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1467472RKRREK
2614622KRLKKKVRK
3615621RLKKKVR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007014416.10.0Pathogenesis related homeodomain protein A, putative isoform 1
SwissprotP487851e-172PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLA0A061GQ970.0A0A061GQ97_THECC; Pathogenesis related homeodomain protein A, putative isoform 1
STRINGVIT_11s0103g00650.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.21e-165pathogenesis related homeodomain protein A
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]